Loading...
Statistics
Advertisement

CRM Klantenportaal - Customer portal
www.crmsupport.be/

Crmsupport.be

Advertisement
Conversion Technology Metas Server
Crmsupport.be is hosted in Belgium . Crmsupport.be uses HTTPS protocol. Number of used technologies: 1. First technologies: Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Microsoft-IIS/7.5.

Technologies in use by Crmsupport.be

Technology

Number of occurences: 1
  • Html

Advertisement

Server Type

  • Microsoft-IIS/7.5

Powered by

  • ASP.NET

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Crmsupport.be

SSL certificate

    • name: /OU=GT05752840/OU=See www.rapidssl.com/resources/cps (c)15/OU=Domain Control Validated - RapidSSL(R)/CN=*.vlootmodule.be
    • subject:
      • OU:
        • 0: GT05752840
        • 1: See www.rapidssl.com/resources/cps (c)15
        • 2: Domain Control Validated - RapidSSL(R)
      • CN: *.vlootmodule.be
    • hash: 94e2b365
    • issuer:
      • C: US
      • O: GeoTrust Inc.
      • CN: RapidSSL SHA256 CA - G3
    • version: 2
    • serialNumber: 348395
    • validFrom: 150625201511Z
    • validTo: 160726150606Z
    • validFrom_time_t: 1435263311
    • validTo_time_t: 1469545566
    • extensions:
      • authorityKeyIdentifier: keyid:C3:9C:F3:FC:D3:46:08:34:BB:CE:46:7F:A0:7C:5B:F3:E2:08:CB:59
      • authorityInfoAccess: OCSP - URI:http://gv.symcd.com CA Issuers - URI:http://gv.symcb.com/gv.crt
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • subjectAltName: DNS:*.vlootmodule.be, DNS:vlootmodule.be
      • crlDistributionPoints: Full Name: URI:http://gv.symcb.com/gv.crl
      • basicConstraints: CA:FALSE
      • certificatePolicies: Policy: 2.23.140.1.2.1 CPS: https://www.rapidssl.com/legal

Meta - Crmsupport.be

Number of occurences: 1
  • Name:
    Content: 0; url=https://portal.crm.be

Server / Hosting

  • IP: 188.93.157.71
  • Latitude: 50.85
  • Longitude: 4.35
  • Country: Belgium

Rname

  • ns.nl.hostbasket.com
  • ns.be.hostbasket.com
  • ns.fr.hostbasket.com
  • mail.crm.be

Target

  • hostmaster.crmhosting.be

HTTP Header Response

HTTP/1.1 200 OK Content-Length: 769 Content-Type: text/html Last-Modified: Tue, 04 Aug 2015 11:48:25 GMT Accept-Ranges: bytes ETag: "f1bdd79abced01:0" Server: Microsoft-IIS/7.5 X-Powered-By: ASP.NET Date: Sun, 10 Jul 2016 03:41:17 GMT X-Cache: MISS from s_fl413 X-Cache-Lookup: MISS from s_fl413:80 Via: 1.1 s_fl413 (squid/3.5.19) Connection: keep-alive

DNS

host: crmsupport.be
  1. class: IN
  2. ttl: 900
  3. type: A
  4. ip: 188.93.157.71
host: crmsupport.be
  1. class: IN
  2. ttl: 900
  3. type: NS
  4. target: ns.nl.hostbasket.com
host: crmsupport.be
  1. class: IN
  2. ttl: 900
  3. type: NS
  4. target: ns.be.hostbasket.com
host: crmsupport.be
  1. class: IN
  2. ttl: 900
  3. type: NS
  4. target: ns.fr.hostbasket.com
host: crmsupport.be
  1. class: IN
  2. ttl: 900
  3. type: SOA
  4. mname: crmsupport.be
  5. rname: hostmaster.crmhosting.be
  6. serial: 2016060701
  7. refresh: 900
  8. retry: 600
  9. expire: 86400
  10. minimum-ttl: 3600
host: crmsupport.be
  1. class: IN
  2. ttl: 900
  3. type: MX
  4. pri: 10
  5. target: mail.crm.be

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.rmsupport.be, www.cdrmsupport.be, www.drmsupport.be, www.crrmsupport.be, www.rrmsupport.be, www.ctrmsupport.be, www.trmsupport.be, www.cvrmsupport.be, www.vrmsupport.be, www.cfrmsupport.be, www.frmsupport.be, www.cgrmsupport.be, www.grmsupport.be, www.chrmsupport.be, www.hrmsupport.be, www.cnrmsupport.be, www.nrmsupport.be, www.cmrmsupport.be, www.mrmsupport.be, www.cjrmsupport.be, www.jrmsupport.be, www.cmsupport.be, www.crimsupport.be, www.cimsupport.be, www.cromsupport.be, www.comsupport.be, www.crlmsupport.be, www.clmsupport.be, www.crlmsupport.be, www.clmsupport.be, www.cr.msupport.be, www.c.msupport.be, www.crsupport.be, www.crmpsupport.be, www.crpsupport.be, www.crmosupport.be, www.crosupport.be, www.crmisupport.be, www.crisupport.be, www.crmksupport.be, www.crksupport.be, www.crm.support.be, www.cr.support.be, www.crmusupport.be, www.crusupport.be, www.crmjsupport.be, www.crjsupport.be, www.crmnsupport.be, www.crnsupport.be, www.crm-support.be, www.cr-support.be, www.crmupport.be, www.crmseupport.be, www.crmeupport.be, www.crmswupport.be, www.crmwupport.be, www.crmsdupport.be, www.crmdupport.be, www.crmsxupport.be, www.crmxupport.be, www.crmsfupport.be, www.crmfupport.be, www.crmsgupport.be, www.crmgupport.be, www.crmstupport.be, www.crmtupport.be, www.crmspport.be, www.crmsuwpport.be, www.crmswpport.be, www.crmsuepport.be, www.crmsepport.be, www.crmsuspport.be, www.crmsspport.be, www.crmsuapport.be, www.crmsapport.be, www.crmsuport.be, www.crmsupiport.be, www.crmsuiport.be, www.crmsupkport.be, www.crmsukport.be, www.crmsupuport.be, www.crmsuuport.be, www.crmsupjport.be, www.crmsujport.be, www.crmsuplport.be, www.crmsulport.be, www.crmsuport.be, www.crmsuppiort.be, www.crmsupiort.be, www.crmsuppkort.be, www.crmsupkort.be, www.crmsuppuort.be, www.crmsupuort.be, www.crmsuppjort.be, www.crmsupjort.be, www.crmsupplort.be, www.crmsuplort.be, www.crmsupprt.be, www.crmsuppobrt.be, www.crmsuppbrt.be, www.crmsuppohrt.be, www.crmsupphrt.be, www.crmsuppogrt.be, www.crmsuppgrt.be, www.crmsuppojrt.be, www.crmsuppjrt.be, www.crmsuppomrt.be, www.crmsuppmrt.be, www.crmsuppo rt.be, www.crmsupp rt.be, www.crmsuppovrt.be, www.crmsuppvrt.be, www.crmsuppot.be, www.crmsupporit.be, www.crmsuppoit.be, www.crmsupporot.be, www.crmsuppoot.be, www.crmsupporlt.be, www.crmsuppolt.be, www.crmsupporlt.be, www.crmsuppolt.be, www.crmsuppor.t.be, www.crmsuppo.t.be, www.crmsuppor.be, www.crmsupportq.be, www.crmsupporq.be, www.crmsupporta.be, www.crmsuppora.be, www.crmsupport .be, www.crmsuppor .be, www.crmsupportw.be, www.crmsupporw.be, www.crmsupporte.be, www.crmsuppore.be, www.crmsupportz.be, www.crmsupporz.be, www.crmsupportx.be, www.crmsupporx.be, www.crmsupportc.be, www.crmsupporc.be,

Other websites we recently analyzed

  1. HADI Maschinenbau GesmbH - Maschinen für die Akkumulatoren-Industrie
    Maschinen für die Akkumulatoren-Industrie - Machines for the accumulator industry
    Austria - 213.145.228.64
    Server software: Apache/1.3.34
    Technology: CSS, Html, Javascript, Php, Swf Object
    Number of Javascript: 1
    Number of meta tags: 5
  2. Nicolaasparochie Amsterdam
    Netherlands - 188.93.150.44
    Server software: Apache/2.2.16 (Debian)
    Technology: CSS, Html, Javascript, jQuery UI, Php, Facebook Box
    Number of Javascript: 12
    Number of meta tags: 3
  3. Common Thread Ministries - Home
    Houston (United States) - 192.254.236.52
    Server software: nginx/1.10.1
    Technology: CSS, Google Font API, Html, Html5
    Number of Javascript: 2
    Number of meta tags: 1
  4. kinderopvangwatergraafsmeer.amsterdam
    Netherlands - 188.93.150.35
    Server software: Apache/2.4.10
    Technology: Html
  5. wvpp.net
    Ottawa (Canada) - 47.90.14.232
    Server software: Microsoft-IIS/7.5
    Technology: Html, Php
    Number of Javascript: 1
    Number of meta tags: 1
  6. postoakfinancialadvisors.com
    Scottsdale (United States) - 50.63.202.65
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  7. Comedian ANT Standup Comedy
    Comedian ANT and his standup comedy and comic
    Scottsdale (United States) - 50.63.202.4
    Server software: Microsoft-IIS/7.5
    Technology: Html
    Number of meta tags: 2
  8. Serenity of Spirit - Home
    San Francisco (United States) - 199.34.228.79
    Server software: Apache
    Technology: CSS, Html, Html5, Javascript, Google Analytics, Quantcast Measurement, Webly
    Number of Javascript: 3
    Number of meta tags: 1
  9. Home
    San Francisco (United States) - 199.34.228.46
    Server software: Apache
    Technology: CSS, Html, Html5, Iframe, Javascript, Php, Google Analytics, Quantcast Measurement, Webly
    Number of Javascript: 6
    Number of meta tags: 2
  10. Isle of Man Probate or Letters of Administration without using a solicitor, lawyer or advocate.
    Manx probate without using an advocate, solicitor, lawyer, or attorney based in the Isle of Man. Help obtaining letters of administration for Isle of Man assets. Isle of Man service address.
    Mountain View (United States) - 162.222.176.137
    G Analytics ID: UA-72246695-1
    Server software:
    Technology: CSS, Html, Javascript, Google Analytics
    Number of Javascript: 4
    Number of meta tags: 9

Check Other Websites